Skip to contents

Generate MSstatsPTM required input format from Protein Prospector output

Usage

ProteinProspectortoMSstatsPTMFormat(
  input,
  annotation,
  input_protein = NULL,
  annotation_protein = NULL,
  use_unmod_peptides = FALSE,
  mod_ids = c("Phospho"),
  useUniquePeptide = TRUE,
  removeFewMeasurements = TRUE,
  removeProtein_with1Feature = FALSE,
  summaryforMultipleRows = sum,
  use_log_file = TRUE,
  append = FALSE,
  verbose = TRUE,
  log_file_path = NULL
)

Arguments

input

Input txt peptide report file from Protein Prospector with "Keep Replicates", "Mods in Peptide", and "Protein Mods" options selected.

annotation

data frame which contains column Run, Fraction, TechRepMixture, Mixture, Channel, BioReplicate, Condition.

input_protein

same as input for global profiling run. Default is NULL.

annotation_protein

same as annotation for global profiling run. Default is NULL.

use_unmod_peptides

If protein_input is not provided, unmodified peptides can be extracted from input to be used in place of a global profiling run. Default is FALSE.

mod_ids

List of modifications of interest. Default is a list with only Phospho. Please note that the 'mod_ids' parameter currently supports lists of size 1 only. Future updates aim to extend its functionality to accommodate lists of greater sizes.

useUniquePeptide

TRUE (default) removes peptides that are assigned for more than one proteins. We assume to use unique peptide for each protein.

removeFewMeasurements

TRUE (default) will remove the features that have 1 or 2 measurements across runs.

removeProtein_with1Feature

TRUE will remove the proteins which have only 1 feature, which is the combination of peptide, precursor charge, fragment and charge. FALSE is default.

summaryforMultipleRows

sum(default) or max - when there are multiple measurements for certain feature and certain run, use highest or sum of multiple intensities.

use_log_file

logical. If TRUE, information about data processing will be saved to a file.

append

logical. If TRUE, information about data processing will be added to an existing log file.

verbose

logical. If TRUE, information about data processing wil be printed to the console.

log_file_path

character. Path to a file to which information about data processing will be saved. If not provided, such a file will be created automatically. If 'append = TRUE', has to be a valid path to a file.

Value

a list of two data.tables named 'PTM' and 'PROTEIN' in the format required by MSstatsPTM.

Author

Anthony Wu

Examples

input = system.file("tinytest/raw_data/ProteinProspector/Prospector_PhosphoTMT.txt",
    package = "MSstatsPTM")
input = data.table::fread(input)
annot = system.file("tinytest/raw_data/ProteinProspector/Annotation.csv",
                                package = "MSstatsPTM")
annot = data.table::fread(annot)
input_protein = system.file("tinytest/raw_data/ProteinProspector/Prospector_TotalTMT.txt",
    package = "MSstatsConvert")
input_protein = data.table::fread(input_protein)
annot_protein = system.file("tinytest/raw_data/ProteinProspector/Annotation.csv",
                                package = "MSstatsConvert")
annot_protein = data.table::fread(annot_protein)
output <- ProteinProspectortoMSstatsPTMFormat(
    input, 
    annot, 
    input_protein,
    annot_protein
)
#> INFO  [2026-04-09 15:19:21] ** Raw data from ProteinProspector imported successfully.
#> INFO  [2026-04-09 15:19:21] ** Raw data from ProteinProspector cleaned successfully.
#> INFO  [2026-04-09 15:19:21] ** Using provided annotation.
#> INFO  [2026-04-09 15:19:21] ** Run and Channel labels were standardized to remove symbols such as '.' or '%'.
#> INFO  [2026-04-09 15:19:21] ** The following options are used:
#>   - Features will be defined by the columns: PeptideSequence, PrecursorCharge
#>   - Shared peptides will be removed.
#>   - Proteins with single feature will not be removed.
#>   - Features with less than 3 measurements within each run will be removed.
#> INFO  [2026-04-09 15:19:21] ** Features with all missing measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** Shared peptides are removed.
#> INFO  [2026-04-09 15:19:21] ** Features with one or two measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** PSMs have been aggregated to peptide ions.
#> INFO  [2026-04-09 15:19:21] ** Run annotation merged with quantification data.
#> INFO  [2026-04-09 15:19:21] ** For peptides overlapped between fractions of Mixture1_1 use the fraction with maximal average abundance.
#> INFO  [2026-04-09 15:19:21] ** Fractions belonging to same mixture have been combined.
#> INFO  [2026-04-09 15:19:21] ** Features with one or two measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** Fractionation handled.
#> INFO  [2026-04-09 15:19:21] ** Updated quantification data to make balanced design. Missing values are marked by NA
#> INFO  [2026-04-09 15:19:21] ** Finished preprocessing. The dataset is ready to be processed by the proteinSummarization function.
#> INFO  [2026-04-09 15:19:21] ** Raw data from ProteinProspector imported successfully.
#> INFO  [2026-04-09 15:19:21] ** Raw data from ProteinProspector cleaned successfully.
#> INFO  [2026-04-09 15:19:21] ** Using provided annotation.
#> INFO  [2026-04-09 15:19:21] ** Run and Channel labels were standardized to remove symbols such as '.' or '%'.
#> INFO  [2026-04-09 15:19:21] ** The following options are used:
#>   - Features will be defined by the columns: PeptideSequence, PrecursorCharge
#>   - Shared peptides will be removed.
#>   - Proteins with single feature will not be removed.
#>   - Features with less than 3 measurements within each run will be removed.
#> INFO  [2026-04-09 15:19:21] ** Features with all missing measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** Shared peptides are removed.
#> INFO  [2026-04-09 15:19:21] ** Features with one or two measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** PSMs have been aggregated to peptide ions.
#> INFO  [2026-04-09 15:19:21] ** Run annotation merged with quantification data.
#> INFO  [2026-04-09 15:19:21] ** For peptides overlapped between fractions of Mixture1_1 use the fraction with maximal average abundance.
#> INFO  [2026-04-09 15:19:21] ** Fractions belonging to same mixture have been combined.
#> INFO  [2026-04-09 15:19:21] ** Features with one or two measurements across channels within each run are removed.
#> INFO  [2026-04-09 15:19:21] ** Fractionation handled.
#> INFO  [2026-04-09 15:19:21] ** Updated quantification data to make balanced design. Missing values are marked by NA
#> INFO  [2026-04-09 15:19:21] ** Finished preprocessing. The dataset is ready to be processed by the proteinSummarization function.
head(output)
#> $PTM
#>          ProteinName                          PeptideSequence Charge
#> 1        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 2        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 3        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 4        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 5        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 6        Q9QYX7_S608                     AAS(Phospho)VQPATASK      2
#> 7   Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 8   Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 9   Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 10  Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 11  Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 12  Q9QYX7_S617_S625 AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK      4
#> 13       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 14       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 15       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 16       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 17       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 18       Q9QYX7_S625          AASVQPATASKSPVPSQQAS(Phospho)PK      4
#> 19       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 20       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 21       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 22       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 23       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 24       P16546_S866                       AKLS(Phospho)ELNQK      3
#> 25       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 26       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 27       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 28       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 29       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 30       Q9QYX7_S599              ALGGELAAIPSS(Phospho)PQPTPK      3
#> 31       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 32       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 33       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 34       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 35       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 36       P16546_S572                  AQLADS(Phospho)FHLQQFFR      3
#> 37       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 38       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 39       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 40       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 41       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 42       Q9QYX7_S289            ATVQQPGPAKS(Phospho)PAQPAGTGK      4
#> 43       P16546_S553                          DALLS(Phospho)R      2
#> 44       P16546_S553                          DALLS(Phospho)R      2
#> 45       P16546_S553                          DALLS(Phospho)R      2
#> 46       P16546_S553                          DALLS(Phospho)R      2
#> 47       P16546_S553                          DALLS(Phospho)R      2
#> 48       P16546_S553                          DALLS(Phospho)R      2
#> 49       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 50       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 51       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 52       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 53       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 54       P16546_S289                      DLAS(Phospho)VQALLR      2
#> 55       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 56       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 57       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 58       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 59       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 60       Q9QYX7_S212             DQGKSEGITKPSLQQPS(Phospho)PK      5
#> 61       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 62       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 63       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 64       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 65       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 66       P16546_S587                    DSDELKS(Phospho)WVNEK      3
#> 67       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 68       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 69       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 70       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 71       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 72       P16546_S484                     DTEQVDNWMS(Phospho)K      3
#> 73       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 74       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 75       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 76       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 77       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 78       P16546_S809                     EKEPIAAS(Phospho)TNR      3
#> 79       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 80       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 81       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 82       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 83       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 84       Q9QYX7_S235             EVIPQDIPSKS(Phospho)VSSQQAEK      3
#> 85       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 86       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 87       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 88       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 89       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 90       Q9QYX7_S177             FNPFDLIS(Phospho)DSEAVQEETTK      3
#> 91       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 92       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 93       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 94       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 95       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 96       Q9QYX7_S179             FNPFDLISDS(Phospho)EAVQEETTK      3
#> 97        Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 98        Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 99        Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 100       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 101       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 102       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      2
#> 103       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 104       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 105       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 106       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 107       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 108       Q9QYX7_S75                 GSVPAAAAES(Phospho)PSMHR      3
#> 109       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 110       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 111       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 112       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 113       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 114       Q9QYX7_S77                 GSVPAAAAESPS(Phospho)MHR      3
#> 115      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 116      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 117      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 118      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 119      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 120      Q6PFD5_S965          HSSATESADS(Phospho)IEIYIPEAQTRL      3
#> 121      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 122      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 123      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 124      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 125      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 126      Q6PFD5_S965           HSSATESADS(Phospho)IEIYIPEAQTR      3
#> 127      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 128      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 129      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 130      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 131      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 132      Q9QYX7_S636                     KELPSKQDS(Phospho)PK      4
#> 133      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 134      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 135      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 136      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 137      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 138      Q9QYX7_S128                    LPGRSPS(Phospho)TISLK      3
#> 139      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 140      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 141      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 142      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 143      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 144      P16546_S324                 LQQS(Phospho)HPLSASQIQVK      3
#> 145      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 146      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 147      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 148      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 149      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 150      P16546_S330                 LQQSHPLSAS(Phospho)QIQVK      3
#> 151      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 152      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 153      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 154      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 155      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 156      Q9QYX7_S636                      QDS(Phospho)PKAPESK      3
#> 157      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 158      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 159      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 160      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 161      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 162      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      3
#> 163      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 164      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 165      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 166      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 167      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 168      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      4
#> 169      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 170      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 171      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 172      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 173      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 174      Q9QYX7_S212                 SEGITKPSLQQPS(Phospho)PK      5
#> 175 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 176 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 177 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 178 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 179 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 180 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      3
#> 181 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 182 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 183 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 184 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 185 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 186 Q9QYX7_S126_S131       SEQKLPGRS(Phospho)PSTIS(Phospho)LK      4
#> 187      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 188      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 189      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 190      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 191      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 192      Q9QYX7_S128                        SPS(Phospho)TISLK      2
#> 193      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 194      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 195      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 196      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 197      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 198      Q9QYX7_S131                        SPSTIS(Phospho)LK      2
#> 199      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 200      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 201      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 202      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 203      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 204      Q9QYX7_S131                        SPSTIS(Phospho)LK      3
#> 205      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 206      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 207      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 208      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 209      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 210      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      3
#> 211      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 212      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 213      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 214      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 215      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 216      Q9QYX7_S625                    SPVPSQQAS(Phospho)PKK      4
#> 217      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 218      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 219      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 220      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 221      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 222      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      2
#> 223      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 224      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 225      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 226      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 227      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 228      Q9QYX7_S625                     SPVPSQQAS(Phospho)PK      3
#> 229      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 230      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 231      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 232      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 233      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 234      Q9QYX7_T112                        SRT(Phospho)TDTFR      3
#> 235      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 236      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 237      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 238      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 239      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 240      Q9QYX7_S165         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK      3
#> 241      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 242      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 243      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 244      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 245      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 246      Q9QYX7_S237                       SVS(Phospho)SQQAEK      2
#> 247      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#> 248      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#> 249      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#> 250      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#> 251      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#> 252      Q9QYX7_S238                       SVSS(Phospho)QQAEK      2
#>                                            PSM  Mixture TechRepMixture
#> 1                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 2                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 3                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 4                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 5                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 6                       AAS(Phospho)VQPATASK_2 Mixture1              1
#> 7   AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 8   AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 9   AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 10  AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 11  AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 12  AASVQPATASKS(Phospho)PVPSQQAS(Phospho)PK_4 Mixture1              1
#> 13           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 14           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 15           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 16           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 17           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 18           AASVQPATASKSPVPSQQAS(Phospho)PK_4 Mixture1              1
#> 19                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 20                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 21                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 22                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 23                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 24                        AKLS(Phospho)ELNQK_3 Mixture1              1
#> 25               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 26               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 27               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 28               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 29               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 30               ALGGELAAIPSS(Phospho)PQPTPK_3 Mixture1              1
#> 31                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 32                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 33                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 34                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 35                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 36                   AQLADS(Phospho)FHLQQFFR_3 Mixture1              1
#> 37             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 38             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 39             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 40             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 41             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 42             ATVQQPGPAKS(Phospho)PAQPAGTGK_4 Mixture1              1
#> 43                           DALLS(Phospho)R_2 Mixture1              1
#> 44                           DALLS(Phospho)R_2 Mixture1              1
#> 45                           DALLS(Phospho)R_2 Mixture1              1
#> 46                           DALLS(Phospho)R_2 Mixture1              1
#> 47                           DALLS(Phospho)R_2 Mixture1              1
#> 48                           DALLS(Phospho)R_2 Mixture1              1
#> 49                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 50                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 51                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 52                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 53                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 54                       DLAS(Phospho)VQALLR_2 Mixture1              1
#> 55              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 56              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 57              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 58              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 59              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 60              DQGKSEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 61                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 62                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 63                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 64                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 65                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 66                     DSDELKS(Phospho)WVNEK_3 Mixture1              1
#> 67                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 68                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 69                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 70                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 71                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 72                      DTEQVDNWMS(Phospho)K_3 Mixture1              1
#> 73                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 74                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 75                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 76                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 77                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 78                      EKEPIAAS(Phospho)TNR_3 Mixture1              1
#> 79              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 80              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 81              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 82              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 83              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 84              EVIPQDIPSKS(Phospho)VSSQQAEK_3 Mixture1              1
#> 85              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 86              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 87              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 88              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 89              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 90              FNPFDLIS(Phospho)DSEAVQEETTK_3 Mixture1              1
#> 91              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 92              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 93              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 94              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 95              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 96              FNPFDLISDS(Phospho)EAVQEETTK_3 Mixture1              1
#> 97                  GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 98                  GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 99                  GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 100                 GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 101                 GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 102                 GSVPAAAAES(Phospho)PSMHR_2 Mixture1              1
#> 103                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 104                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 105                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 106                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 107                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 108                 GSVPAAAAES(Phospho)PSMHR_3 Mixture1              1
#> 109                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 110                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 111                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 112                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 113                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 114                 GSVPAAAAESPS(Phospho)MHR_3 Mixture1              1
#> 115          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 116          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 117          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 118          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 119          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 120          HSSATESADS(Phospho)IEIYIPEAQTRL_3 Mixture1              1
#> 121           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 122           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 123           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 124           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 125           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 126           HSSATESADS(Phospho)IEIYIPEAQTR_3 Mixture1              1
#> 127                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 128                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 129                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 130                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 131                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 132                     KELPSKQDS(Phospho)PK_4 Mixture1              1
#> 133                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 134                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 135                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 136                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 137                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 138                    LPGRSPS(Phospho)TISLK_3 Mixture1              1
#> 139                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 140                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 141                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 142                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 143                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 144                 LQQS(Phospho)HPLSASQIQVK_3 Mixture1              1
#> 145                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 146                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 147                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 148                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 149                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 150                 LQQSHPLSAS(Phospho)QIQVK_3 Mixture1              1
#> 151                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 152                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 153                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 154                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 155                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 156                      QDS(Phospho)PKAPESK_3 Mixture1              1
#> 157                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 158                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 159                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 160                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 161                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 162                 SEGITKPSLQQPS(Phospho)PK_3 Mixture1              1
#> 163                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 164                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 165                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 166                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 167                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 168                 SEGITKPSLQQPS(Phospho)PK_4 Mixture1              1
#> 169                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 170                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 171                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 172                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 173                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 174                 SEGITKPSLQQPS(Phospho)PK_5 Mixture1              1
#> 175       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 176       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 177       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 178       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 179       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 180       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_3 Mixture1              1
#> 181       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 182       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 183       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 184       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 185       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 186       SEQKLPGRS(Phospho)PSTIS(Phospho)LK_4 Mixture1              1
#> 187                        SPS(Phospho)TISLK_2 Mixture1              1
#> 188                        SPS(Phospho)TISLK_2 Mixture1              1
#> 189                        SPS(Phospho)TISLK_2 Mixture1              1
#> 190                        SPS(Phospho)TISLK_2 Mixture1              1
#> 191                        SPS(Phospho)TISLK_2 Mixture1              1
#> 192                        SPS(Phospho)TISLK_2 Mixture1              1
#> 193                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 194                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 195                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 196                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 197                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 198                        SPSTIS(Phospho)LK_2 Mixture1              1
#> 199                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 200                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 201                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 202                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 203                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 204                        SPSTIS(Phospho)LK_3 Mixture1              1
#> 205                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 206                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 207                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 208                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 209                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 210                    SPVPSQQAS(Phospho)PKK_3 Mixture1              1
#> 211                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 212                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 213                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 214                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 215                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 216                    SPVPSQQAS(Phospho)PKK_4 Mixture1              1
#> 217                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 218                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 219                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 220                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 221                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 222                     SPVPSQQAS(Phospho)PK_2 Mixture1              1
#> 223                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 224                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 225                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 226                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 227                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 228                     SPVPSQQAS(Phospho)PK_3 Mixture1              1
#> 229                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 230                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 231                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 232                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 233                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 234                        SRT(Phospho)TDTFR_3 Mixture1              1
#> 235         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 236         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 237         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 238         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 239         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 240         SSMMPGFFSDVNPLSAVSS(Phospho)VVNK_3 Mixture1              1
#> 241                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 242                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 243                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 244                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 245                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 246                       SVS(Phospho)SQQAEK_2 Mixture1              1
#> 247                       SVSS(Phospho)QQAEK_2 Mixture1              1
#> 248                       SVSS(Phospho)QQAEK_2 Mixture1              1
#> 249                       SVSS(Phospho)QQAEK_2 Mixture1              1
#> 250                       SVSS(Phospho)QQAEK_2 Mixture1              1
#> 251                       SVSS(Phospho)QQAEK_2 Mixture1              1
#> 252                       SVSS(Phospho)QQAEK_2 Mixture1              1
#>            Run Channel BioReplicate Condition Intensity
#> 1   Mixture1_1  Int126           S1     Young     35677
#> 2   Mixture1_1  Int127           S2     Young     39390
#> 3   Mixture1_1  Int128           S3     Young     31921
#> 4   Mixture1_1  Int129           S4       Old     42021
#> 5   Mixture1_1  Int130           S5       Old     23273
#> 6   Mixture1_1  Int131           S6       Old     34693
#> 7   Mixture1_1  Int126           S1     Young     32103
#> 8   Mixture1_1  Int127           S2     Young     45075
#> 9   Mixture1_1  Int128           S3     Young     65793
#> 10  Mixture1_1  Int129           S4       Old     53048
#> 11  Mixture1_1  Int130           S5       Old     43588
#> 12  Mixture1_1  Int131           S6       Old     49907
#> 13  Mixture1_1  Int126           S1     Young     11003
#> 14  Mixture1_1  Int127           S2     Young     24600
#> 15  Mixture1_1  Int128           S3     Young     23359
#> 16  Mixture1_1  Int129           S4       Old     29631
#> 17  Mixture1_1  Int130           S5       Old     32580
#> 18  Mixture1_1  Int131           S6       Old     26484
#> 19  Mixture1_1  Int126           S1     Young     21352
#> 20  Mixture1_1  Int127           S2     Young     20708
#> 21  Mixture1_1  Int128           S3     Young     24370
#> 22  Mixture1_1  Int129           S4       Old     27013
#> 23  Mixture1_1  Int130           S5       Old     21308
#> 24  Mixture1_1  Int131           S6       Old     26018
#> 25  Mixture1_1  Int126           S1     Young     39471
#> 26  Mixture1_1  Int127           S2     Young     48551
#> 27  Mixture1_1  Int128           S3     Young     62397
#> 28  Mixture1_1  Int129           S4       Old     54429
#> 29  Mixture1_1  Int130           S5       Old     35338
#> 30  Mixture1_1  Int131           S6       Old     49178
#> 31  Mixture1_1  Int126           S1     Young     10241
#> 32  Mixture1_1  Int127           S2     Young     16523
#> 33  Mixture1_1  Int128           S3     Young     17101
#> 34  Mixture1_1  Int129           S4       Old     16818
#> 35  Mixture1_1  Int130           S5       Old     12515
#> 36  Mixture1_1  Int131           S6       Old     14038
#> 37  Mixture1_1  Int126           S1     Young      5112
#> 38  Mixture1_1  Int127           S2     Young      6876
#> 39  Mixture1_1  Int128           S3     Young      6456
#> 40  Mixture1_1  Int129           S4       Old      9866
#> 41  Mixture1_1  Int130           S5       Old      5502
#> 42  Mixture1_1  Int131           S6       Old      7183
#> 43  Mixture1_1  Int126           S1     Young    140924
#> 44  Mixture1_1  Int127           S2     Young    147982
#> 45  Mixture1_1  Int128           S3     Young    219516
#> 46  Mixture1_1  Int129           S4       Old    187403
#> 47  Mixture1_1  Int130           S5       Old    175154
#> 48  Mixture1_1  Int131           S6       Old    175012
#> 49  Mixture1_1  Int126           S1     Young     14510
#> 50  Mixture1_1  Int127           S2     Young     20882
#> 51  Mixture1_1  Int128           S3     Young     22037
#> 52  Mixture1_1  Int129           S4       Old     20808
#> 53  Mixture1_1  Int130           S5       Old     15400
#> 54  Mixture1_1  Int131           S6       Old     19311
#> 55  Mixture1_1  Int126           S1     Young     43809
#> 56  Mixture1_1  Int127           S2     Young     58956
#> 57  Mixture1_1  Int128           S3     Young     76681
#> 58  Mixture1_1  Int129           S4       Old     66692
#> 59  Mixture1_1  Int130           S5       Old     82919
#> 60  Mixture1_1  Int131           S6       Old     77978
#> 61  Mixture1_1  Int126           S1     Young    107793
#> 62  Mixture1_1  Int127           S2     Young    107894
#> 63  Mixture1_1  Int128           S3     Young    136424
#> 64  Mixture1_1  Int129           S4       Old    137355
#> 65  Mixture1_1  Int130           S5       Old    133689
#> 66  Mixture1_1  Int131           S6       Old    131555
#> 67  Mixture1_1  Int126           S1     Young     72649
#> 68  Mixture1_1  Int127           S2     Young     69923
#> 69  Mixture1_1  Int128           S3     Young     82825
#> 70  Mixture1_1  Int129           S4       Old     96140
#> 71  Mixture1_1  Int130           S5       Old     62012
#> 72  Mixture1_1  Int131           S6       Old     91102
#> 73  Mixture1_1  Int126           S1     Young     31963
#> 74  Mixture1_1  Int127           S2     Young     30481
#> 75  Mixture1_1  Int128           S3     Young     39043
#> 76  Mixture1_1  Int129           S4       Old     36968
#> 77  Mixture1_1  Int130           S5       Old     26465
#> 78  Mixture1_1  Int131           S6       Old     33886
#> 79  Mixture1_1  Int126           S1     Young     30719
#> 80  Mixture1_1  Int127           S2     Young     32962
#> 81  Mixture1_1  Int128           S3     Young     26548
#> 82  Mixture1_1  Int129           S4       Old     35883
#> 83  Mixture1_1  Int130           S5       Old     25994
#> 84  Mixture1_1  Int131           S6       Old     31855
#> 85  Mixture1_1  Int126           S1     Young     11785
#> 86  Mixture1_1  Int127           S2     Young     15112
#> 87  Mixture1_1  Int128           S3     Young     15933
#> 88  Mixture1_1  Int129           S4       Old     13880
#> 89  Mixture1_1  Int130           S5       Old     11916
#> 90  Mixture1_1  Int131           S6       Old     13206
#> 91  Mixture1_1  Int126           S1     Young      5357
#> 92  Mixture1_1  Int127           S2     Young      9176
#> 93  Mixture1_1  Int128           S3     Young     10395
#> 94  Mixture1_1  Int129           S4       Old      8729
#> 95  Mixture1_1  Int130           S5       Old      5227
#> 96  Mixture1_1  Int131           S6       Old     11059
#> 97  Mixture1_1  Int126           S1     Young      5308
#> 98  Mixture1_1  Int127           S2     Young      8466
#> 99  Mixture1_1  Int128           S3     Young      9011
#> 100 Mixture1_1  Int129           S4       Old      9498
#> 101 Mixture1_1  Int130           S5       Old      5131
#> 102 Mixture1_1  Int131           S6       Old     10197
#> 103 Mixture1_1  Int126           S1     Young     72828
#> 104 Mixture1_1  Int127           S2     Young     80934
#> 105 Mixture1_1  Int128           S3     Young     90459
#> 106 Mixture1_1  Int129           S4       Old     78753
#> 107 Mixture1_1  Int130           S5       Old     76561
#> 108 Mixture1_1  Int131           S6       Old     94021
#> 109 Mixture1_1  Int126           S1     Young     65974
#> 110 Mixture1_1  Int127           S2     Young     76727
#> 111 Mixture1_1  Int128           S3     Young     82841
#> 112 Mixture1_1  Int129           S4       Old     80603
#> 113 Mixture1_1  Int130           S5       Old     59127
#> 114 Mixture1_1  Int131           S6       Old     74477
#> 115 Mixture1_1  Int126           S1     Young     37368
#> 116 Mixture1_1  Int127           S2     Young     44992
#> 117 Mixture1_1  Int128           S3     Young     50119
#> 118 Mixture1_1  Int129           S4       Old     49058
#> 119 Mixture1_1  Int130           S5       Old     47124
#> 120 Mixture1_1  Int131           S6       Old     47436
#> 121 Mixture1_1  Int126           S1     Young     25756
#> 122 Mixture1_1  Int127           S2     Young     33050
#> 123 Mixture1_1  Int128           S3     Young     30903
#> 124 Mixture1_1  Int129           S4       Old     32438
#> 125 Mixture1_1  Int130           S5       Old     25555
#> 126 Mixture1_1  Int131           S6       Old     31425
#> 127 Mixture1_1  Int126           S1     Young     44399
#> 128 Mixture1_1  Int127           S2     Young     46672
#> 129 Mixture1_1  Int128           S3     Young     55586
#> 130 Mixture1_1  Int129           S4       Old     52200
#> 131 Mixture1_1  Int130           S5       Old     38990
#> 132 Mixture1_1  Int131           S6       Old     46493
#> 133 Mixture1_1  Int126           S1     Young     36736
#> 134 Mixture1_1  Int127           S2     Young     41448
#> 135 Mixture1_1  Int128           S3     Young     40465
#> 136 Mixture1_1  Int129           S4       Old     45374
#> 137 Mixture1_1  Int130           S5       Old     27285
#> 138 Mixture1_1  Int131           S6       Old     34630
#> 139 Mixture1_1  Int126           S1     Young     17696
#> 140 Mixture1_1  Int127           S2     Young     20819
#> 141 Mixture1_1  Int128           S3     Young     26085
#> 142 Mixture1_1  Int129           S4       Old     27945
#> 143 Mixture1_1  Int130           S5       Old     21373
#> 144 Mixture1_1  Int131           S6       Old     25470
#> 145 Mixture1_1  Int126           S1     Young     69061
#> 146 Mixture1_1  Int127           S2     Young     67346
#> 147 Mixture1_1  Int128           S3     Young    103392
#> 148 Mixture1_1  Int129           S4       Old     86397
#> 149 Mixture1_1  Int130           S5       Old     87316
#> 150 Mixture1_1  Int131           S6       Old     81399
#> 151 Mixture1_1  Int126           S1     Young     67959
#> 152 Mixture1_1  Int127           S2     Young     56744
#> 153 Mixture1_1  Int128           S3     Young     80015
#> 154 Mixture1_1  Int129           S4       Old     64970
#> 155 Mixture1_1  Int130           S5       Old     60874
#> 156 Mixture1_1  Int131           S6       Old     65219
#> 157 Mixture1_1  Int126           S1     Young     59892
#> 158 Mixture1_1  Int127           S2     Young     55796
#> 159 Mixture1_1  Int128           S3     Young     89693
#> 160 Mixture1_1  Int129           S4       Old     62793
#> 161 Mixture1_1  Int130           S5       Old     62563
#> 162 Mixture1_1  Int131           S6       Old     67739
#> 163 Mixture1_1  Int126           S1     Young     37715
#> 164 Mixture1_1  Int127           S2     Young     37284
#> 165 Mixture1_1  Int128           S3     Young     47498
#> 166 Mixture1_1  Int129           S4       Old     38339
#> 167 Mixture1_1  Int130           S5       Old     28866
#> 168 Mixture1_1  Int131           S6       Old     39553
#> 169 Mixture1_1  Int126           S1     Young     13559
#> 170 Mixture1_1  Int127           S2     Young     16787
#> 171 Mixture1_1  Int128           S3     Young     25183
#> 172 Mixture1_1  Int129           S4       Old     16857
#> 173 Mixture1_1  Int130           S5       Old     16661
#> 174 Mixture1_1  Int131           S6       Old     19321
#> 175 Mixture1_1  Int126           S1     Young     79078
#> 176 Mixture1_1  Int127           S2     Young    109026
#> 177 Mixture1_1  Int128           S3     Young    126574
#> 178 Mixture1_1  Int129           S4       Old    112539
#> 179 Mixture1_1  Int130           S5       Old    108233
#> 180 Mixture1_1  Int131           S6       Old    118963
#> 181 Mixture1_1  Int126           S1     Young     27374
#> 182 Mixture1_1  Int127           S2     Young     36066
#> 183 Mixture1_1  Int128           S3     Young     45088
#> 184 Mixture1_1  Int129           S4       Old     43403
#> 185 Mixture1_1  Int130           S5       Old     35079
#> 186 Mixture1_1  Int131           S6       Old     41550
#> 187 Mixture1_1  Int126           S1     Young     74020
#> 188 Mixture1_1  Int127           S2     Young     84756
#> 189 Mixture1_1  Int128           S3     Young     84232
#> 190 Mixture1_1  Int129           S4       Old     81831
#> 191 Mixture1_1  Int130           S5       Old     57146
#> 192 Mixture1_1  Int131           S6       Old     67194
#> 193 Mixture1_1  Int126           S1     Young    233957
#> 194 Mixture1_1  Int127           S2     Young    238535
#> 195 Mixture1_1  Int128           S3     Young    357265
#> 196 Mixture1_1  Int129           S4       Old    268053
#> 197 Mixture1_1  Int130           S5       Old    262127
#> 198 Mixture1_1  Int131           S6       Old    280330
#> 199 Mixture1_1  Int126           S1     Young     18445
#> 200 Mixture1_1  Int127           S2     Young     21808
#> 201 Mixture1_1  Int128           S3     Young     27893
#> 202 Mixture1_1  Int129           S4       Old     24551
#> 203 Mixture1_1  Int130           S5       Old     23956
#> 204 Mixture1_1  Int131           S6       Old     23432
#> 205 Mixture1_1  Int126           S1     Young     53404
#> 206 Mixture1_1  Int127           S2     Young     52476
#> 207 Mixture1_1  Int128           S3     Young     62672
#> 208 Mixture1_1  Int129           S4       Old     57006
#> 209 Mixture1_1  Int130           S5       Old     48006
#> 210 Mixture1_1  Int131           S6       Old     54185
#> 211 Mixture1_1  Int126           S1     Young     24960
#> 212 Mixture1_1  Int127           S2     Young     20458
#> 213 Mixture1_1  Int128           S3     Young     29394
#> 214 Mixture1_1  Int129           S4       Old     27968
#> 215 Mixture1_1  Int130           S5       Old     23712
#> 216 Mixture1_1  Int131           S6       Old     24336
#> 217 Mixture1_1  Int126           S1     Young     73451
#> 218 Mixture1_1  Int127           S2     Young     69715
#> 219 Mixture1_1  Int128           S3     Young     98877
#> 220 Mixture1_1  Int129           S4       Old     79049
#> 221 Mixture1_1  Int130           S5       Old     77695
#> 222 Mixture1_1  Int131           S6       Old     81938
#> 223 Mixture1_1  Int126           S1     Young    110067
#> 224 Mixture1_1  Int127           S2     Young    108569
#> 225 Mixture1_1  Int128           S3     Young    129873
#> 226 Mixture1_1  Int129           S4       Old    108131
#> 227 Mixture1_1  Int130           S5       Old    107446
#> 228 Mixture1_1  Int131           S6       Old    101541
#> 229 Mixture1_1  Int126           S1     Young     28628
#> 230 Mixture1_1  Int127           S2     Young     32874
#> 231 Mixture1_1  Int128           S3     Young     38196
#> 232 Mixture1_1  Int129           S4       Old     35274
#> 233 Mixture1_1  Int130           S5       Old     26482
#> 234 Mixture1_1  Int131           S6       Old     28653
#> 235 Mixture1_1  Int126           S1     Young      5135
#> 236 Mixture1_1  Int127           S2     Young      5607
#> 237 Mixture1_1  Int128           S3     Young      3937
#> 238 Mixture1_1  Int129           S4       Old      4364
#> 239 Mixture1_1  Int130           S5       Old      2594
#> 240 Mixture1_1  Int131           S6       Old      3114
#> 241 Mixture1_1  Int126           S1     Young     24503
#> 242 Mixture1_1  Int127           S2     Young     23789
#> 243 Mixture1_1  Int128           S3     Young     29818
#> 244 Mixture1_1  Int129           S4       Old     24642
#> 245 Mixture1_1  Int130           S5       Old     23918
#> 246 Mixture1_1  Int131           S6       Old     22867
#> 247 Mixture1_1  Int126           S1     Young     32482
#> 248 Mixture1_1  Int127           S2     Young     32183
#> 249 Mixture1_1  Int128           S3     Young     41125
#> 250 Mixture1_1  Int129           S4       Old     35346
#> 251 Mixture1_1  Int130           S5       Old     33958
#> 252 Mixture1_1  Int131           S6       Old     36180
#> 
#> $PROTEIN
#> Object of class "MSstatsValidated"
#>     ProteinName                       PeptideSequence Charge
#> 1        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 2        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 3        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 4        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 5        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 6        Q9DCN2                    APDAWDYSQGFVNEEMIR      2
#> 7        Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 8        Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 9        Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 10       Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 11       Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 12       Q9DCN2                    APDAWDYSQGFVNEEMIR      3
#> 13       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 14       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 15       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 16       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 17       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 18       Q60778 DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR      4
#> 19       Q6NS52                              DDGQHVWR      3
#> 20       Q6NS52                              DDGQHVWR      3
#> 21       Q6NS52                              DDGQHVWR      3
#> 22       Q6NS52                              DDGQHVWR      3
#> 23       Q6NS52                              DDGQHVWR      3
#> 24       Q6NS52                              DDGQHVWR      3
#> 25       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 26       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 27       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 28       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 29       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 30       Q6NS52           DHILPPTTICPVVLTMPSAGASVPEER      3
#> 31       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 32       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 33       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 34       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 35       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 36       Q9DCN2       DHLPTPGEEPLILMCGPPPMIQFACLPNLER      4
#> 37       Q6NS52                          DIESSTEIMLDR      2
#> 38       Q6NS52                          DIESSTEIMLDR      2
#> 39       Q6NS52                          DIESSTEIMLDR      2
#> 40       Q6NS52                          DIESSTEIMLDR      2
#> 41       Q6NS52                          DIESSTEIMLDR      2
#> 42       Q6NS52                          DIESSTEIMLDR      2
#> 43       Q6NS52                          DIESSTEIMLDR      3
#> 44       Q6NS52                          DIESSTEIMLDR      3
#> 45       Q6NS52                          DIESSTEIMLDR      3
#> 46       Q6NS52                          DIESSTEIMLDR      3
#> 47       Q6NS52                          DIESSTEIMLDR      3
#> 48       Q6NS52                          DIESSTEIMLDR      3
#> 49       Q9DCN2                          DILLRPELEELR      2
#> 50       Q9DCN2                          DILLRPELEELR      2
#> 51       Q9DCN2                          DILLRPELEELR      2
#> 52       Q9DCN2                          DILLRPELEELR      2
#> 53       Q9DCN2                          DILLRPELEELR      2
#> 54       Q9DCN2                          DILLRPELEELR      2
#> 55       Q9DCN2                          DILLRPELEELR      3
#> 56       Q9DCN2                          DILLRPELEELR      3
#> 57       Q9DCN2                          DILLRPELEELR      3
#> 58       Q9DCN2                          DILLRPELEELR      3
#> 59       Q9DCN2                          DILLRPELEELR      3
#> 60       Q9DCN2                          DILLRPELEELR      3
#> 61       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 62       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 63       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 64       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 65       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 66       P16546     DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 67       Q6NS52                           DIVCYLSLLER      2
#> 68       Q6NS52                           DIVCYLSLLER      2
#> 69       Q6NS52                           DIVCYLSLLER      2
#> 70       Q6NS52                           DIVCYLSLLER      2
#> 71       Q6NS52                           DIVCYLSLLER      2
#> 72       Q6NS52                           DIVCYLSLLER      2
#> 73       Q6NS52                           DIVCYLSLLER      3
#> 74       Q6NS52                           DIVCYLSLLER      3
#> 75       Q6NS52                           DIVCYLSLLER      3
#> 76       Q6NS52                           DIVCYLSLLER      3
#> 77       Q6NS52                           DIVCYLSLLER      3
#> 78       Q6NS52                           DIVCYLSLLER      3
#> 79       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 80       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 81       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 82       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 83       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 84       P16546                 DLNSQADSLMTSSAFDTSQVK      3
#> 85       Q6NS52                                DVPDFR      2
#> 86       Q6NS52                                DVPDFR      2
#> 87       Q6NS52                                DVPDFR      2
#> 88       Q6NS52                                DVPDFR      2
#> 89       Q6NS52                                DVPDFR      2
#> 90       Q6NS52                                DVPDFR      2
#> 91       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 92       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 93       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 94       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 95       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 96       P16546                 EAFLNTEDKGDSLDSVEALIK      3
#> 97       P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 98       P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 99       P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 100      P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 101      P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 102      P16546                 EAIVTSEELGQDLEHVEVLQK      3
#> 103      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 104      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 105      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 106      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 107      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 108      P16546                 EAIVTSEELGQDLEHVEVLQK      4
#> 109      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 110      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 111      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 112      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 113      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 114      P16546               EKEPIVGSTDYGKDEDSAEALLK      4
#> 115      P16546                     EQADYCVSHMKPYVDGK      4
#> 116      P16546                     EQADYCVSHMKPYVDGK      4
#> 117      P16546                     EQADYCVSHMKPYVDGK      4
#> 118      P16546                     EQADYCVSHMKPYVDGK      4
#> 119      P16546                     EQADYCVSHMKPYVDGK      4
#> 120      P16546                     EQADYCVSHMKPYVDGK      4
#> 121      Q9DCN2                              EVISPDTR      2
#> 122      Q9DCN2                              EVISPDTR      2
#> 123      Q9DCN2                              EVISPDTR      2
#> 124      Q9DCN2                              EVISPDTR      2
#> 125      Q9DCN2                              EVISPDTR      2
#> 126      Q9DCN2                              EVISPDTR      2
#> 127      P16546                        FEEFQTDLAAHEER      2
#> 128      P16546                        FEEFQTDLAAHEER      2
#> 129      P16546                        FEEFQTDLAAHEER      2
#> 130      P16546                        FEEFQTDLAAHEER      2
#> 131      P16546                        FEEFQTDLAAHEER      2
#> 132      P16546                        FEEFQTDLAAHEER      2
#> 133      P16546                        FEEFQTDLAAHEER      3
#> 134      P16546                        FEEFQTDLAAHEER      3
#> 135      P16546                        FEEFQTDLAAHEER      3
#> 136      P16546                        FEEFQTDLAAHEER      3
#> 137      P16546                        FEEFQTDLAAHEER      3
#> 138      P16546                        FEEFQTDLAAHEER      3
#> 139      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 140      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 141      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 142      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 143      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 144      P16546      GEIDAHEDSFKSADESGQALLAASHYASDEVR      5
#> 145      Q9DCN2                              GFVDLVVK      2
#> 146      Q9DCN2                              GFVDLVVK      2
#> 147      Q9DCN2                              GFVDLVVK      2
#> 148      Q9DCN2                              GFVDLVVK      2
#> 149      Q9DCN2                              GFVDLVVK      2
#> 150      Q9DCN2                              GFVDLVVK      2
#> 151      P16546                      GNAMVEEGHFAAEDVK      2
#> 152      P16546                      GNAMVEEGHFAAEDVK      2
#> 153      P16546                      GNAMVEEGHFAAEDVK      2
#> 154      P16546                      GNAMVEEGHFAAEDVK      2
#> 155      P16546                      GNAMVEEGHFAAEDVK      2
#> 156      P16546                      GNAMVEEGHFAAEDVK      2
#> 157      P16546                      GNAMVEEGHFAAEDVK      3
#> 158      P16546                      GNAMVEEGHFAAEDVK      3
#> 159      P16546                      GNAMVEEGHFAAEDVK      3
#> 160      P16546                      GNAMVEEGHFAAEDVK      3
#> 161      P16546                      GNAMVEEGHFAAEDVK      3
#> 162      P16546                      GNAMVEEGHFAAEDVK      3
#> 163      Q6NS52                          GRPEDKLEFMFR      4
#> 164      Q6NS52                          GRPEDKLEFMFR      4
#> 165      Q6NS52                          GRPEDKLEFMFR      4
#> 166      Q6NS52                          GRPEDKLEFMFR      4
#> 167      Q6NS52                          GRPEDKLEFMFR      4
#> 168      Q6NS52                          GRPEDKLEFMFR      4
#> 169      Q6NS52                          GSDKRPTLTDAK      4
#> 170      Q6NS52                          GSDKRPTLTDAK      4
#> 171      Q6NS52                          GSDKRPTLTDAK      4
#> 172      Q6NS52                          GSDKRPTLTDAK      4
#> 173      Q6NS52                          GSDKRPTLTDAK      4
#> 174      Q6NS52                          GSDKRPTLTDAK      4
#> 175      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 176      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 177      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 178      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 179      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 180      Q6NS52                     HPPVAILPLGTGNDLAR      3
#> 181      P16546                        HQAFEAELHANADR      3
#> 182      P16546                        HQAFEAELHANADR      3
#> 183      P16546                        HQAFEAELHANADR      3
#> 184      P16546                        HQAFEAELHANADR      3
#> 185      P16546                        HQAFEAELHANADR      3
#> 186      P16546                        HQAFEAELHANADR      3
#> 187      P16546                        HQAFEAELHANADR      4
#> 188      P16546                        HQAFEAELHANADR      4
#> 189      P16546                        HQAFEAELHANADR      4
#> 190      P16546                        HQAFEAELHANADR      4
#> 191      P16546                        HQAFEAELHANADR      4
#> 192      P16546                        HQAFEAELHANADR      4
#> 193      P16546                   IAALQAFADQLIAVDHYAK      3
#> 194      P16546                   IAALQAFADQLIAVDHYAK      3
#> 195      P16546                   IAALQAFADQLIAVDHYAK      3
#> 196      P16546                   IAALQAFADQLIAVDHYAK      3
#> 197      P16546                   IAALQAFADQLIAVDHYAK      3
#> 198      P16546                   IAALQAFADQLIAVDHYAK      3
#> 199      P16546                   IAALQAFADQLIAVDHYAK      4
#> 200      P16546                   IAALQAFADQLIAVDHYAK      4
#> 201      P16546                   IAALQAFADQLIAVDHYAK      4
#> 202      P16546                   IAALQAFADQLIAVDHYAK      4
#> 203      P16546                   IAALQAFADQLIAVDHYAK      4
#> 204      P16546                   IAALQAFADQLIAVDHYAK      4
#> 205      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 206      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 207      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 208      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 209      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 210      Q9DCN2           IDGNLVIRPYTPVSSDDDKGFVDLVVK      4
#> 211      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 212      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 213      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 214      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 215      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 216      Q9DCN2                   IDGNLVIRPYTPVSSDDDK      3
#> 217      Q9DCN2                              IGDTIEFR      2
#> 218      Q9DCN2                              IGDTIEFR      2
#> 219      Q9DCN2                              IGDTIEFR      2
#> 220      Q9DCN2                              IGDTIEFR      2
#> 221      Q9DCN2                              IGDTIEFR      2
#> 222      Q9DCN2                              IGDTIEFR      2
#> 223      Q6NS52                       ILKDIESSTEIMLDR      3
#> 224      Q6NS52                       ILKDIESSTEIMLDR      3
#> 225      Q6NS52                       ILKDIESSTEIMLDR      3
#> 226      Q6NS52                       ILKDIESSTEIMLDR      3
#> 227      Q6NS52                       ILKDIESSTEIMLDR      3
#> 228      Q6NS52                       ILKDIESSTEIMLDR      3
#> 229      Q9WV30                            IVVQPETQHR      3
#> 230      Q9WV30                            IVVQPETQHR      3
#> 231      Q9WV30                            IVVQPETQHR      3
#> 232      Q9WV30                            IVVQPETQHR      3
#> 233      Q9WV30                            IVVQPETQHR      3
#> 234      Q9WV30                            IVVQPETQHR      3
#> 235      Q6NS52                            LAQCSSVVIR      2
#> 236      Q6NS52                            LAQCSSVVIR      2
#> 237      Q6NS52                            LAQCSSVVIR      2
#> 238      Q6NS52                            LAQCSSVVIR      2
#> 239      Q6NS52                            LAQCSSVVIR      2
#> 240      Q6NS52                            LAQCSSVVIR      2
#> 241      P16546                  LDETGNLMISEGHFASETIR      3
#> 242      P16546                  LDETGNLMISEGHFASETIR      3
#> 243      P16546                  LDETGNLMISEGHFASETIR      3
#> 244      P16546                  LDETGNLMISEGHFASETIR      3
#> 245      P16546                  LDETGNLMISEGHFASETIR      3
#> 246      P16546                  LDETGNLMISEGHFASETIR      3
#> 247      Q6NS52                                LEFMFR      2
#> 248      Q6NS52                                LEFMFR      2
#> 249      Q6NS52                                LEFMFR      2
#> 250      Q6NS52                                LEFMFR      2
#> 251      Q6NS52                                LEFMFR      2
#> 252      Q6NS52                                LEFMFR      2
#> 253      Q9DCN2                         LIDKEVISPDTRR      4
#> 254      Q9DCN2                         LIDKEVISPDTRR      4
#> 255      Q9DCN2                         LIDKEVISPDTRR      4
#> 256      Q9DCN2                         LIDKEVISPDTRR      4
#> 257      Q9DCN2                         LIDKEVISPDTRR      4
#> 258      Q9DCN2                         LIDKEVISPDTRR      4
#> 259      Q9DCN2                          LIDKEVISPDTR      3
#> 260      Q9DCN2                          LIDKEVISPDTR      3
#> 261      Q9DCN2                          LIDKEVISPDTR      3
#> 262      Q9DCN2                          LIDKEVISPDTR      3
#> 263      Q9DCN2                          LIDKEVISPDTR      3
#> 264      Q9DCN2                          LIDKEVISPDTR      3
#> 265      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 266      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 267      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 268      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 269      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 270      Q9DCN2             LWYTVDKAPDAWDYSQGFVNEEMIR      4
#> 271      Q9DCN2                               LWYTVDK      2
#> 272      Q9DCN2                               LWYTVDK      2
#> 273      Q9DCN2                               LWYTVDK      2
#> 274      Q9DCN2                               LWYTVDK      2
#> 275      Q9DCN2                               LWYTVDK      2
#> 276      Q9DCN2                               LWYTVDK      2
#> 277      Q9DCN2                             MSQYLENMK      2
#> 278      Q9DCN2                             MSQYLENMK      2
#> 279      Q9DCN2                             MSQYLENMK      2
#> 280      Q9DCN2                             MSQYLENMK      2
#> 281      Q9DCN2                             MSQYLENMK      2
#> 282      Q9DCN2                             MSQYLENMK      2
#> 283      Q9DCN2                             MSQYLENMK      3
#> 284      Q9DCN2                             MSQYLENMK      3
#> 285      Q9DCN2                             MSQYLENMK      3
#> 286      Q9DCN2                             MSQYLENMK      3
#> 287      Q9DCN2                             MSQYLENMK      3
#> 288      Q9DCN2                             MSQYLENMK      3
#> 289      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 290      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 291      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 292      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 293      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 294      P16546                 NQALNTDNYGHDLASVQALQR      3
#> 295      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 296      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 297      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 298      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 299      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 300      P16546                 NQALNTDNYGHDLASVQALQR      4
#> 301      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 302      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 303      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 304      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 305      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 306      Q6NS52                     NTDVMHHYWVEGNCPTK      4
#> 307      Q6NS52                        QDILNQTIDFEGFK      2
#> 308      Q6NS52                        QDILNQTIDFEGFK      2
#> 309      Q6NS52                        QDILNQTIDFEGFK      2
#> 310      Q6NS52                        QDILNQTIDFEGFK      2
#> 311      Q6NS52                        QDILNQTIDFEGFK      2
#> 312      Q6NS52                        QDILNQTIDFEGFK      2
#> 313      Q6NS52                        QDILNQTIDFEGFK      3
#> 314      Q6NS52                        QDILNQTIDFEGFK      3
#> 315      Q6NS52                        QDILNQTIDFEGFK      3
#> 316      Q6NS52                        QDILNQTIDFEGFK      3
#> 317      Q6NS52                        QDILNQTIDFEGFK      3
#> 318      Q6NS52                        QDILNQTIDFEGFK      3
#> 319      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 320      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 321      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 322      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 323      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 324      P16546              QDLEDSLQAQQYFADANEAESWMR      3
#> 325      P16546                    QEFAQHANAFHQWIQETR      4
#> 326      P16546                    QEFAQHANAFHQWIQETR      4
#> 327      P16546                    QEFAQHANAFHQWIQETR      4
#> 328      P16546                    QEFAQHANAFHQWIQETR      4
#> 329      P16546                    QEFAQHANAFHQWIQETR      4
#> 330      P16546                    QEFAQHANAFHQWIQETR      4
#> 331      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 332      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 333      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 334      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 335      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 336      P16546        QETFDAGLQAFQQEGIANITALKDQLLAAK      4
#> 337      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 338      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 339      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 340      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 341      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 342      P16546               QETFDAGLQAFQQEGIANITALK      3
#> 343      P16546                        QFQDAGHFDAENIK      3
#> 344      P16546                        QFQDAGHFDAENIK      3
#> 345      P16546                        QFQDAGHFDAENIK      3
#> 346      P16546                        QFQDAGHFDAENIK      3
#> 347      P16546                        QFQDAGHFDAENIK      3
#> 348      P16546                        QFQDAGHFDAENIK      3
#> 349      Q6NS52                             QGLCCSFCK      2
#> 350      Q6NS52                             QGLCCSFCK      2
#> 351      Q6NS52                             QGLCCSFCK      2
#> 352      Q6NS52                             QGLCCSFCK      2
#> 353      Q6NS52                             QGLCCSFCK      2
#> 354      Q6NS52                             QGLCCSFCK      2
#> 355      Q6NS52                             QGLCCSFCK      3
#> 356      Q6NS52                             QGLCCSFCK      3
#> 357      Q6NS52                             QGLCCSFCK      3
#> 358      Q6NS52                             QGLCCSFCK      3
#> 359      Q6NS52                             QGLCCSFCK      3
#> 360      Q6NS52                             QGLCCSFCK      3
#> 361      P45591                              QIIVEEAK      2
#> 362      P45591                              QIIVEEAK      2
#> 363      P45591                              QIIVEEAK      2
#> 364      P45591                              QIIVEEAK      2
#> 365      P45591                              QIIVEEAK      2
#> 366      P45591                              QIIVEEAK      2
#> 367      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 368      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 369      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 370      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 371      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 372      P16546              QQVAPMDDETGKELVLALYDYQEK      3
#> 373      P16546                        QQYEQCMDLQLFYR      2
#> 374      P16546                        QQYEQCMDLQLFYR      2
#> 375      P16546                        QQYEQCMDLQLFYR      2
#> 376      P16546                        QQYEQCMDLQLFYR      2
#> 377      P16546                        QQYEQCMDLQLFYR      2
#> 378      P16546                        QQYEQCMDLQLFYR      2
#> 379      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 380      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 381      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 382      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 383      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 384      P16546             RQDLEDSLQAQQYFADANEAESWMR      3
#> 385      P16546               SADESGQALLAASHYASDEVREK      4
#> 386      P16546               SADESGQALLAASHYASDEVREK      4
#> 387      P16546               SADESGQALLAASHYASDEVREK      4
#> 388      P16546               SADESGQALLAASHYASDEVREK      4
#> 389      P16546               SADESGQALLAASHYASDEVREK      4
#> 390      P16546               SADESGQALLAASHYASDEVREK      4
#> 391      P16546                 SADESGQALLAASHYASDEVR      2
#> 392      P16546                 SADESGQALLAASHYASDEVR      2
#> 393      P16546                 SADESGQALLAASHYASDEVR      2
#> 394      P16546                 SADESGQALLAASHYASDEVR      2
#> 395      P16546                 SADESGQALLAASHYASDEVR      2
#> 396      P16546                 SADESGQALLAASHYASDEVR      2
#> 397      P16546                 SADESGQALLAASHYASDEVR      3
#> 398      P16546                 SADESGQALLAASHYASDEVR      3
#> 399      P16546                 SADESGQALLAASHYASDEVR      3
#> 400      P16546                 SADESGQALLAASHYASDEVR      3
#> 401      P16546                 SADESGQALLAASHYASDEVR      3
#> 402      P16546                 SADESGQALLAASHYASDEVR      3
#> 403      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 404      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 405      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 406      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 407      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 408      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      3
#> 409      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 410      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 411      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 412      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 413      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 414      P16546         SLGYDLPMVEEGEPDPEFEAILDTVDPNR      4
#> 415      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 416      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 417      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 418      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 419      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 420      Q6NS52                   SLPMQIDGEPWMQTPCTIK      3
#> 421      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 422      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 423      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 424      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 425      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 426      Q6NS52                   SLPMQIDGEPWMQTPCTIK      4
#> 427      Q9DCN2                                SNPVVR      2
#> 428      Q9DCN2                                SNPVVR      2
#> 429      Q9DCN2                                SNPVVR      2
#> 430      Q9DCN2                                SNPVVR      2
#> 431      Q9DCN2                                SNPVVR      2
#> 432      Q9DCN2                                SNPVVR      2
#> 433      P16546                    SSLSSAQADFNQLAELDR      2
#> 434      P16546                    SSLSSAQADFNQLAELDR      2
#> 435      P16546                    SSLSSAQADFNQLAELDR      2
#> 436      P16546                    SSLSSAQADFNQLAELDR      2
#> 437      P16546                    SSLSSAQADFNQLAELDR      2
#> 438      P16546                    SSLSSAQADFNQLAELDR      2
#> 439      Q6NS52                       SSPANTCSPEVIHLK      3
#> 440      Q6NS52                       SSPANTCSPEVIHLK      3
#> 441      Q6NS52                       SSPANTCSPEVIHLK      3
#> 442      Q6NS52                       SSPANTCSPEVIHLK      3
#> 443      Q6NS52                       SSPANTCSPEVIHLK      3
#> 444      Q6NS52                       SSPANTCSPEVIHLK      3
#> 445      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 446      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 447      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 448      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 449      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 450      Q9DCN2                     STPAITLENPDIKYPLR      3
#> 451      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 452      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 453      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 454      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 455      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 456      Q9DCN2                     STPAITLENPDIKYPLR      4
#> 457      Q9DCN2                         STPAITLENPDIK      2
#> 458      Q9DCN2                         STPAITLENPDIK      2
#> 459      Q9DCN2                         STPAITLENPDIK      2
#> 460      Q9DCN2                         STPAITLENPDIK      2
#> 461      Q9DCN2                         STPAITLENPDIK      2
#> 462      Q9DCN2                         STPAITLENPDIK      2
#> 463      Q9DCN2                         STPAITLENPDIK      3
#> 464      Q9DCN2                         STPAITLENPDIK      3
#> 465      Q9DCN2                         STPAITLENPDIK      3
#> 466      Q9DCN2                         STPAITLENPDIK      3
#> 467      Q9DCN2                         STPAITLENPDIK      3
#> 468      Q9DCN2                         STPAITLENPDIK      3
#> 469      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 470      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 471      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 472      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 473      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 474      Q9DCN2                   SVGMIAGGTGITPMLQVIR      3
#> 475      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 476      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 477      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 478      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 479      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 480      P16546             TYLLDGSCMVEESGTLESQLEATKR      3
#> 481      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 482      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 483      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 484      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 485      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 486      P16546              TYLLDGSCMVEESGTLESQLEATK      3
#> 487      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 488      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 489      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 490      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 491      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 492      P16546   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK      4
#> 493      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 494      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 495      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 496      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 497      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 498      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      3
#> 499      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 500      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 501      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 502      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 503      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 504      P16546         VAEDLESEGLMAEEVQAVQQQEVYGAMPR      4
#> 505      Q6NS52                          WGGGYEGENLMK      2
#> 506      Q6NS52                          WGGGYEGENLMK      2
#> 507      Q6NS52                          WGGGYEGENLMK      2
#> 508      Q6NS52                          WGGGYEGENLMK      2
#> 509      Q6NS52                          WGGGYEGENLMK      2
#> 510      Q6NS52                          WGGGYEGENLMK      2
#> 511      Q6NS52                          WGGGYEGENLMK      3
#> 512      Q6NS52                          WGGGYEGENLMK      3
#> 513      Q6NS52                          WGGGYEGENLMK      3
#> 514      Q6NS52                          WGGGYEGENLMK      3
#> 515      Q6NS52                          WGGGYEGENLMK      3
#> 516      Q6NS52                          WGGGYEGENLMK      3
#> 517      Q6NS52                               YAEYSTK      2
#> 518      Q6NS52                               YAEYSTK      2
#> 519      Q6NS52                               YAEYSTK      2
#> 520      Q6NS52                               YAEYSTK      2
#> 521      Q6NS52                               YAEYSTK      2
#> 522      Q6NS52                               YAEYSTK      2
#> 523      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#> 524      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#> 525      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#> 526      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#> 527      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#> 528      P16546                YTEHSTVGLAQQWDQLDQLGMR      3
#>                                         PSM  Mixture TechRepMixture        Run
#> 1                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 2                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 3                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 4                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 5                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 6                      APDAWDYSQGFVNEEMIR_2 Mixture1              1 Mixture1_1
#> 7                      APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 8                      APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 9                      APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 10                     APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 11                     APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 12                     APDAWDYSQGFVNEEMIR_3 Mixture1              1 Mixture1_1
#> 13  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 14  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 15  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 16  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 17  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 18  DASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPR_4 Mixture1              1 Mixture1_1
#> 19                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 20                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 21                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 22                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 23                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 24                               DDGQHVWR_3 Mixture1              1 Mixture1_1
#> 25            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 26            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 27            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 28            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 29            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 30            DHILPPTTICPVVLTMPSAGASVPEER_3 Mixture1              1 Mixture1_1
#> 31        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 32        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 33        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 34        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 35        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 36        DHLPTPGEEPLILMCGPPPMIQFACLPNLER_4 Mixture1              1 Mixture1_1
#> 37                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 38                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 39                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 40                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 41                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 42                           DIESSTEIMLDR_2 Mixture1              1 Mixture1_1
#> 43                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 44                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 45                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 46                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 47                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 48                           DIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 49                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 50                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 51                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 52                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 53                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 54                           DILLRPELEELR_2 Mixture1              1 Mixture1_1
#> 55                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 56                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 57                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 58                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 59                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 60                           DILLRPELEELR_3 Mixture1              1 Mixture1_1
#> 61      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 62      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 63      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 64      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 65      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 66      DINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 67                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 68                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 69                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 70                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 71                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 72                            DIVCYLSLLER_2 Mixture1              1 Mixture1_1
#> 73                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 74                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 75                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 76                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 77                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 78                            DIVCYLSLLER_3 Mixture1              1 Mixture1_1
#> 79                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 80                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 81                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 82                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 83                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 84                  DLNSQADSLMTSSAFDTSQVK_3 Mixture1              1 Mixture1_1
#> 85                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 86                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 87                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 88                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 89                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 90                                 DVPDFR_2 Mixture1              1 Mixture1_1
#> 91                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 92                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 93                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 94                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 95                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 96                  EAFLNTEDKGDSLDSVEALIK_3 Mixture1              1 Mixture1_1
#> 97                  EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 98                  EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 99                  EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 100                 EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 101                 EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 102                 EAIVTSEELGQDLEHVEVLQK_3 Mixture1              1 Mixture1_1
#> 103                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 104                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 105                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 106                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 107                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 108                 EAIVTSEELGQDLEHVEVLQK_4 Mixture1              1 Mixture1_1
#> 109               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 110               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 111               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 112               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 113               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 114               EKEPIVGSTDYGKDEDSAEALLK_4 Mixture1              1 Mixture1_1
#> 115                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 116                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 117                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 118                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 119                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 120                     EQADYCVSHMKPYVDGK_4 Mixture1              1 Mixture1_1
#> 121                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 122                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 123                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 124                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 125                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 126                              EVISPDTR_2 Mixture1              1 Mixture1_1
#> 127                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 128                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 129                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 130                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 131                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 132                        FEEFQTDLAAHEER_2 Mixture1              1 Mixture1_1
#> 133                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 134                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 135                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 136                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 137                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 138                        FEEFQTDLAAHEER_3 Mixture1              1 Mixture1_1
#> 139      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 140      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 141      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 142      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 143      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 144      GEIDAHEDSFKSADESGQALLAASHYASDEVR_5 Mixture1              1 Mixture1_1
#> 145                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 146                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 147                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 148                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 149                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 150                              GFVDLVVK_2 Mixture1              1 Mixture1_1
#> 151                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 152                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 153                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 154                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 155                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 156                      GNAMVEEGHFAAEDVK_2 Mixture1              1 Mixture1_1
#> 157                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 158                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 159                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 160                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 161                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 162                      GNAMVEEGHFAAEDVK_3 Mixture1              1 Mixture1_1
#> 163                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 164                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 165                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 166                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 167                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 168                          GRPEDKLEFMFR_4 Mixture1              1 Mixture1_1
#> 169                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 170                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 171                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 172                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 173                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 174                          GSDKRPTLTDAK_4 Mixture1              1 Mixture1_1
#> 175                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 176                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 177                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 178                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 179                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 180                     HPPVAILPLGTGNDLAR_3 Mixture1              1 Mixture1_1
#> 181                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 182                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 183                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 184                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 185                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 186                        HQAFEAELHANADR_3 Mixture1              1 Mixture1_1
#> 187                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 188                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 189                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 190                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 191                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 192                        HQAFEAELHANADR_4 Mixture1              1 Mixture1_1
#> 193                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 194                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 195                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 196                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 197                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 198                   IAALQAFADQLIAVDHYAK_3 Mixture1              1 Mixture1_1
#> 199                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 200                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 201                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 202                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 203                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 204                   IAALQAFADQLIAVDHYAK_4 Mixture1              1 Mixture1_1
#> 205           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 206           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 207           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 208           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 209           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 210           IDGNLVIRPYTPVSSDDDKGFVDLVVK_4 Mixture1              1 Mixture1_1
#> 211                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 212                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 213                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 214                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 215                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 216                   IDGNLVIRPYTPVSSDDDK_3 Mixture1              1 Mixture1_1
#> 217                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 218                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 219                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 220                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 221                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 222                              IGDTIEFR_2 Mixture1              1 Mixture1_1
#> 223                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 224                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 225                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 226                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 227                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 228                       ILKDIESSTEIMLDR_3 Mixture1              1 Mixture1_1
#> 229                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 230                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 231                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 232                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 233                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 234                            IVVQPETQHR_3 Mixture1              1 Mixture1_1
#> 235                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 236                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 237                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 238                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 239                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 240                            LAQCSSVVIR_2 Mixture1              1 Mixture1_1
#> 241                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 242                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 243                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 244                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 245                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 246                  LDETGNLMISEGHFASETIR_3 Mixture1              1 Mixture1_1
#> 247                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 248                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 249                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 250                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 251                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 252                                LEFMFR_2 Mixture1              1 Mixture1_1
#> 253                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 254                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 255                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 256                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 257                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 258                         LIDKEVISPDTRR_4 Mixture1              1 Mixture1_1
#> 259                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 260                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 261                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 262                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 263                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 264                          LIDKEVISPDTR_3 Mixture1              1 Mixture1_1
#> 265             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 266             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 267             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 268             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 269             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 270             LWYTVDKAPDAWDYSQGFVNEEMIR_4 Mixture1              1 Mixture1_1
#> 271                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 272                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 273                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 274                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 275                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 276                               LWYTVDK_2 Mixture1              1 Mixture1_1
#> 277                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 278                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 279                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 280                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 281                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 282                             MSQYLENMK_2 Mixture1              1 Mixture1_1
#> 283                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 284                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 285                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 286                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 287                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 288                             MSQYLENMK_3 Mixture1              1 Mixture1_1
#> 289                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 290                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 291                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 292                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 293                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 294                 NQALNTDNYGHDLASVQALQR_3 Mixture1              1 Mixture1_1
#> 295                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 296                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 297                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 298                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 299                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 300                 NQALNTDNYGHDLASVQALQR_4 Mixture1              1 Mixture1_1
#> 301                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 302                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 303                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 304                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 305                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 306                     NTDVMHHYWVEGNCPTK_4 Mixture1              1 Mixture1_1
#> 307                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 308                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 309                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 310                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 311                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 312                        QDILNQTIDFEGFK_2 Mixture1              1 Mixture1_1
#> 313                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 314                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 315                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 316                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 317                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 318                        QDILNQTIDFEGFK_3 Mixture1              1 Mixture1_1
#> 319              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 320              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 321              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 322              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 323              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 324              QDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 325                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 326                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 327                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 328                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 329                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 330                    QEFAQHANAFHQWIQETR_4 Mixture1              1 Mixture1_1
#> 331        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 332        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 333        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 334        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 335        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 336        QETFDAGLQAFQQEGIANITALKDQLLAAK_4 Mixture1              1 Mixture1_1
#> 337               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 338               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 339               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 340               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 341               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 342               QETFDAGLQAFQQEGIANITALK_3 Mixture1              1 Mixture1_1
#> 343                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 344                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 345                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 346                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 347                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 348                        QFQDAGHFDAENIK_3 Mixture1              1 Mixture1_1
#> 349                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 350                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 351                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 352                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 353                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 354                             QGLCCSFCK_2 Mixture1              1 Mixture1_1
#> 355                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 356                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 357                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 358                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 359                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 360                             QGLCCSFCK_3 Mixture1              1 Mixture1_1
#> 361                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 362                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 363                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 364                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 365                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 366                              QIIVEEAK_2 Mixture1              1 Mixture1_1
#> 367              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 368              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 369              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 370              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 371              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 372              QQVAPMDDETGKELVLALYDYQEK_3 Mixture1              1 Mixture1_1
#> 373                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 374                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 375                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 376                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 377                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 378                        QQYEQCMDLQLFYR_2 Mixture1              1 Mixture1_1
#> 379             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 380             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 381             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 382             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 383             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 384             RQDLEDSLQAQQYFADANEAESWMR_3 Mixture1              1 Mixture1_1
#> 385               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 386               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 387               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 388               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 389               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 390               SADESGQALLAASHYASDEVREK_4 Mixture1              1 Mixture1_1
#> 391                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 392                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 393                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 394                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 395                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 396                 SADESGQALLAASHYASDEVR_2 Mixture1              1 Mixture1_1
#> 397                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 398                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 399                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 400                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 401                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 402                 SADESGQALLAASHYASDEVR_3 Mixture1              1 Mixture1_1
#> 403         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 404         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 405         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 406         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 407         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 408         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_3 Mixture1              1 Mixture1_1
#> 409         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 410         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 411         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 412         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 413         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 414         SLGYDLPMVEEGEPDPEFEAILDTVDPNR_4 Mixture1              1 Mixture1_1
#> 415                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 416                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 417                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 418                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 419                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 420                   SLPMQIDGEPWMQTPCTIK_3 Mixture1              1 Mixture1_1
#> 421                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 422                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 423                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 424                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 425                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 426                   SLPMQIDGEPWMQTPCTIK_4 Mixture1              1 Mixture1_1
#> 427                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 428                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 429                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 430                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 431                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 432                                SNPVVR_2 Mixture1              1 Mixture1_1
#> 433                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 434                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 435                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 436                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 437                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 438                    SSLSSAQADFNQLAELDR_2 Mixture1              1 Mixture1_1
#> 439                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 440                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 441                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 442                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 443                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 444                       SSPANTCSPEVIHLK_3 Mixture1              1 Mixture1_1
#> 445                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 446                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 447                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 448                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 449                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 450                     STPAITLENPDIKYPLR_3 Mixture1              1 Mixture1_1
#> 451                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 452                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 453                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 454                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 455                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 456                     STPAITLENPDIKYPLR_4 Mixture1              1 Mixture1_1
#> 457                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 458                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 459                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 460                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 461                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 462                         STPAITLENPDIK_2 Mixture1              1 Mixture1_1
#> 463                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 464                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 465                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 466                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 467                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 468                         STPAITLENPDIK_3 Mixture1              1 Mixture1_1
#> 469                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 470                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 471                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 472                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 473                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 474                   SVGMIAGGTGITPMLQVIR_3 Mixture1              1 Mixture1_1
#> 475             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 476             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 477             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 478             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 479             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 480             TYLLDGSCMVEESGTLESQLEATKR_3 Mixture1              1 Mixture1_1
#> 481              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 482              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 483              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 484              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 485              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 486              TYLLDGSCMVEESGTLESQLEATK_3 Mixture1              1 Mixture1_1
#> 487   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 488   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 489   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 490   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 491   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 492   VAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSK_4 Mixture1              1 Mixture1_1
#> 493         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 494         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 495         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 496         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 497         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 498         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_3 Mixture1              1 Mixture1_1
#> 499         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 500         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 501         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 502         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 503         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 504         VAEDLESEGLMAEEVQAVQQQEVYGAMPR_4 Mixture1              1 Mixture1_1
#> 505                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 506                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 507                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 508                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 509                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 510                          WGGGYEGENLMK_2 Mixture1              1 Mixture1_1
#> 511                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 512                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 513                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 514                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 515                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 516                          WGGGYEGENLMK_3 Mixture1              1 Mixture1_1
#> 517                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 518                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 519                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 520                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 521                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 522                               YAEYSTK_2 Mixture1              1 Mixture1_1
#> 523                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#> 524                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#> 525                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#> 526                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#> 527                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#> 528                YTEHSTVGLAQQWDQLDQLGMR_3 Mixture1              1 Mixture1_1
#>     Channel BioReplicate Condition  Intensity
#> 1    Int126           S1     Young    7861.00
#> 2    Int127           S2     Young    4463.00
#> 3    Int128           S3     Young    6274.00
#> 4    Int129           S4      Aged    7005.00
#> 5    Int130           S5      Aged    4565.00
#> 6    Int131           S6      Aged    5753.00
#> 7    Int126           S1     Young    4556.00
#> 8    Int127           S2     Young    4058.00
#> 9    Int128           S3     Young    5983.00
#> 10   Int129           S4      Aged    4357.00
#> 11   Int130           S5      Aged   15606.00
#> 12   Int131           S6      Aged    4101.00
#> 13   Int126           S1     Young    1195.00
#> 14   Int127           S2     Young     -92.62
#> 15   Int128           S3     Young    1751.00
#> 16   Int129           S4      Aged    -149.90
#> 17   Int130           S5      Aged    1792.00
#> 18   Int131           S6      Aged    1841.00
#> 19   Int126           S1     Young  127316.00
#> 20   Int127           S2     Young   87173.00
#> 21   Int128           S3     Young  140839.00
#> 22   Int129           S4      Aged   93095.00
#> 23   Int130           S5      Aged   93943.00
#> 24   Int131           S6      Aged  108463.00
#> 25   Int126           S1     Young    4484.00
#> 26   Int127           S2     Young    3381.00
#> 27   Int128           S3     Young    4392.00
#> 28   Int129           S4      Aged    2651.00
#> 29   Int130           S5      Aged    3069.00
#> 30   Int131           S6      Aged    3295.00
#> 31   Int126           S1     Young    4678.00
#> 32   Int127           S2     Young    5114.00
#> 33   Int128           S3     Young    5142.00
#> 34   Int129           S4      Aged    4154.00
#> 35   Int130           S5      Aged    2985.00
#> 36   Int131           S6      Aged    3170.00
#> 37   Int126           S1     Young   86175.00
#> 38   Int127           S2     Young   72498.00
#> 39   Int128           S3     Young  103458.00
#> 40   Int129           S4      Aged   77897.00
#> 41   Int130           S5      Aged   68510.00
#> 42   Int131           S6      Aged   78627.00
#> 43   Int126           S1     Young    7860.00
#> 44   Int127           S2     Young    8355.00
#> 45   Int128           S3     Young    9418.00
#> 46   Int129           S4      Aged    8931.00
#> 47   Int130           S5      Aged    6691.00
#> 48   Int131           S6      Aged    8421.00
#> 49   Int126           S1     Young   14490.00
#> 50   Int127           S2     Young   12342.00
#> 51   Int128           S3     Young   14130.00
#> 52   Int129           S4      Aged   17157.00
#> 53   Int130           S5      Aged   13235.00
#> 54   Int131           S6      Aged   13156.00
#> 55   Int126           S1     Young  103119.00
#> 56   Int127           S2     Young   82124.00
#> 57   Int128           S3     Young  115322.00
#> 58   Int129           S4      Aged  114894.00
#> 59   Int130           S5      Aged  102774.00
#> 60   Int131           S6      Aged  107063.00
#> 61   Int126           S1     Young         NA
#> 62   Int127           S2     Young    7542.00
#> 63   Int128           S3     Young    8204.00
#> 64   Int129           S4      Aged   10578.00
#> 65   Int130           S5      Aged    9828.00
#> 66   Int131           S6      Aged   11855.00
#> 67   Int126           S1     Young   37063.00
#> 68   Int127           S2     Young   32420.00
#> 69   Int128           S3     Young   50419.00
#> 70   Int129           S4      Aged   34120.00
#> 71   Int130           S5      Aged   39668.00
#> 72   Int131           S6      Aged   42109.00
#> 73   Int126           S1     Young    1431.00
#> 74   Int127           S2     Young    -112.40
#> 75   Int128           S3     Young    1797.00
#> 76   Int129           S4      Aged    2305.00
#> 77   Int130           S5      Aged    -179.30
#> 78   Int131           S6      Aged    2232.00
#> 79   Int126           S1     Young  114763.00
#> 80   Int127           S2     Young   94417.00
#> 81   Int128           S3     Young  123461.00
#> 82   Int129           S4      Aged  112301.00
#> 83   Int130           S5      Aged  102351.00
#> 84   Int131           S6      Aged  106529.00
#> 85   Int126           S1     Young   75058.00
#> 86   Int127           S2     Young   69123.00
#> 87   Int128           S3     Young   91346.00
#> 88   Int129           S4      Aged   75810.00
#> 89   Int130           S5      Aged   66094.00
#> 90   Int131           S6      Aged   80694.00
#> 91   Int126           S1     Young   58543.00
#> 92   Int127           S2     Young   46293.00
#> 93   Int128           S3     Young   62226.00
#> 94   Int129           S4      Aged   51159.00
#> 95   Int130           S5      Aged   55753.00
#> 96   Int131           S6      Aged   53177.00
#> 97   Int126           S1     Young  129452.00
#> 98   Int127           S2     Young   98333.00
#> 99   Int128           S3     Young  145714.00
#> 100  Int129           S4      Aged  104492.00
#> 101  Int130           S5      Aged  105819.00
#> 102  Int131           S6      Aged  105938.00
#> 103  Int126           S1     Young    9310.00
#> 104  Int127           S2     Young   10878.00
#> 105  Int128           S3     Young   10768.00
#> 106  Int129           S4      Aged    9343.00
#> 107  Int130           S5      Aged    8329.00
#> 108  Int131           S6      Aged    8114.00
#> 109  Int126           S1     Young   97907.00
#> 110  Int127           S2     Young   90016.00
#> 111  Int128           S3     Young  117288.00
#> 112  Int129           S4      Aged   93059.00
#> 113  Int130           S5      Aged  109068.00
#> 114  Int131           S6      Aged   98845.00
#> 115  Int126           S1     Young   74487.00
#> 116  Int127           S2     Young   65132.00
#> 117  Int128           S3     Young   91415.00
#> 118  Int129           S4      Aged   73564.00
#> 119  Int130           S5      Aged   81503.00
#> 120  Int131           S6      Aged   68471.00
#> 121  Int126           S1     Young  248198.00
#> 122  Int127           S2     Young  203349.00
#> 123  Int128           S3     Young  263747.00
#> 124  Int129           S4      Aged  245719.00
#> 125  Int130           S5      Aged  195150.00
#> 126  Int131           S6      Aged  214466.00
#> 127  Int126           S1     Young   57905.00
#> 128  Int127           S2     Young   59155.00
#> 129  Int128           S3     Young   80130.00
#> 130  Int129           S4      Aged   67666.00
#> 131  Int130           S5      Aged   67548.00
#> 132  Int131           S6      Aged   65014.00
#> 133  Int126           S1     Young   77053.00
#> 134  Int127           S2     Young   64489.00
#> 135  Int128           S3     Young   94444.00
#> 136  Int129           S4      Aged   78504.00
#> 137  Int130           S5      Aged   91308.00
#> 138  Int131           S6      Aged   76634.00
#> 139  Int126           S1     Young   39221.00
#> 140  Int127           S2     Young   46197.00
#> 141  Int128           S3     Young   41622.00
#> 142  Int129           S4      Aged   68307.00
#> 143  Int130           S5      Aged   68667.00
#> 144  Int131           S6      Aged   78506.00
#> 145  Int126           S1     Young  199082.00
#> 146  Int127           S2     Young  142694.00
#> 147  Int128           S3     Young  189549.00
#> 148  Int129           S4      Aged  177034.00
#> 149  Int130           S5      Aged  142824.00
#> 150  Int131           S6      Aged  146929.00
#> 151  Int126           S1     Young   72686.00
#> 152  Int127           S2     Young   72763.00
#> 153  Int128           S3     Young   97587.00
#> 154  Int129           S4      Aged   83471.00
#> 155  Int130           S5      Aged   83319.00
#> 156  Int131           S6      Aged   87863.00
#> 157  Int126           S1     Young  519086.00
#> 158  Int127           S2     Young  477185.00
#> 159  Int128           S3     Young  583524.00
#> 160  Int129           S4      Aged  431363.00
#> 161  Int130           S5      Aged  504550.00
#> 162  Int131           S6      Aged  449005.00
#> 163  Int126           S1     Young   33401.00
#> 164  Int127           S2     Young   27558.00
#> 165  Int128           S3     Young   39045.00
#> 166  Int129           S4      Aged   28675.00
#> 167  Int130           S5      Aged   33019.00
#> 168  Int131           S6      Aged   31281.00
#> 169  Int126           S1     Young  102499.00
#> 170  Int127           S2     Young   96299.00
#> 171  Int128           S3     Young  127058.00
#> 172  Int129           S4      Aged  105268.00
#> 173  Int130           S5      Aged  110667.00
#> 174  Int131           S6      Aged  119409.00
#> 175  Int126           S1     Young   12665.00
#> 176  Int127           S2     Young   13581.00
#> 177  Int128           S3     Young   16917.00
#> 178  Int129           S4      Aged   10973.00
#> 179  Int130           S5      Aged    7587.00
#> 180  Int131           S6      Aged   18806.00
#> 181  Int126           S1     Young  209946.00
#> 182  Int127           S2     Young  220134.00
#> 183  Int128           S3     Young  283347.00
#> 184  Int129           S4      Aged  240173.00
#> 185  Int130           S5      Aged  256718.00
#> 186  Int131           S6      Aged  263683.00
#> 187  Int126           S1     Young   51803.00
#> 188  Int127           S2     Young   47016.00
#> 189  Int128           S3     Young   46274.00
#> 190  Int129           S4      Aged   51613.00
#> 191  Int130           S5      Aged   44682.00
#> 192  Int131           S6      Aged   46237.00
#> 193  Int126           S1     Young   26874.00
#> 194  Int127           S2     Young   26781.00
#> 195  Int128           S3     Young   34611.00
#> 196  Int129           S4      Aged   25013.00
#> 197  Int130           S5      Aged   34561.00
#> 198  Int131           S6      Aged   31381.00
#> 199  Int126           S1     Young    3546.00
#> 200  Int127           S2     Young    4606.00
#> 201  Int128           S3     Young    4275.00
#> 202  Int129           S4      Aged    4190.00
#> 203  Int130           S5      Aged    2733.00
#> 204  Int131           S6      Aged    4590.00
#> 205  Int126           S1     Young   17042.00
#> 206  Int127           S2     Young   15018.00
#> 207  Int128           S3     Young   19853.00
#> 208  Int129           S4      Aged   18954.00
#> 209  Int130           S5      Aged   19135.00
#> 210  Int131           S6      Aged   20350.00
#> 211  Int126           S1     Young  156331.00
#> 212  Int127           S2     Young  114585.00
#> 213  Int128           S3     Young  144215.00
#> 214  Int129           S4      Aged  136545.00
#> 215  Int130           S5      Aged  125707.00
#> 216  Int131           S6      Aged  114838.00
#> 217  Int126           S1     Young  217046.00
#> 218  Int127           S2     Young  180073.00
#> 219  Int128           S3     Young  218970.00
#> 220  Int129           S4      Aged  219230.00
#> 221  Int130           S5      Aged  189245.00
#> 222  Int131           S6      Aged  208423.00
#> 223  Int126           S1     Young   11645.00
#> 224  Int127           S2     Young   15196.00
#> 225  Int128           S3     Young   19474.00
#> 226  Int129           S4      Aged   15814.00
#> 227  Int130           S5      Aged   19126.00
#> 228  Int131           S6      Aged   21208.00
#> 229  Int126           S1     Young   43518.00
#> 230  Int127           S2     Young   49149.00
#> 231  Int128           S3     Young   63325.00
#> 232  Int129           S4      Aged   59733.00
#> 233  Int130           S5      Aged   62849.00
#> 234  Int131           S6      Aged   66898.00
#> 235  Int126           S1     Young  169230.00
#> 236  Int127           S2     Young  155667.00
#> 237  Int128           S3     Young  195401.00
#> 238  Int129           S4      Aged  181479.00
#> 239  Int130           S5      Aged  163101.00
#> 240  Int131           S6      Aged  199154.00
#> 241  Int126           S1     Young   19753.00
#> 242  Int127           S2     Young   17551.00
#> 243  Int128           S3     Young   37157.00
#> 244  Int129           S4      Aged   63362.00
#> 245  Int130           S5      Aged   11638.00
#> 246  Int131           S6      Aged  102340.00
#> 247  Int126           S1     Young   90595.00
#> 248  Int127           S2     Young   57583.00
#> 249  Int128           S3     Young  100001.00
#> 250  Int129           S4      Aged   62687.00
#> 251  Int130           S5      Aged   57489.00
#> 252  Int131           S6      Aged   65730.00
#> 253  Int126           S1     Young   54026.00
#> 254  Int127           S2     Young   88645.00
#> 255  Int128           S3     Young   84440.00
#> 256  Int129           S4      Aged  115526.00
#> 257  Int130           S5      Aged  115833.00
#> 258  Int131           S6      Aged  121097.00
#> 259  Int126           S1     Young  353271.00
#> 260  Int127           S2     Young  359141.00
#> 261  Int128           S3     Young  410776.00
#> 262  Int129           S4      Aged  441094.00
#> 263  Int130           S5      Aged  456423.00
#> 264  Int131           S6      Aged  454753.00
#> 265  Int126           S1     Young    3951.00
#> 266  Int127           S2     Young    4348.00
#> 267  Int128           S3     Young    5596.00
#> 268  Int129           S4      Aged    4875.00
#> 269  Int130           S5      Aged    4991.00
#> 270  Int131           S6      Aged    5230.00
#> 271  Int126           S1     Young  230262.00
#> 272  Int127           S2     Young  120946.00
#> 273  Int128           S3     Young  202121.00
#> 274  Int129           S4      Aged  140565.00
#> 275  Int130           S5      Aged  126462.00
#> 276  Int131           S6      Aged  131735.00
#> 277  Int126           S1     Young  274369.00
#> 278  Int127           S2     Young  260641.00
#> 279  Int128           S3     Young  333608.00
#> 280  Int129           S4      Aged  292828.00
#> 281  Int130           S5      Aged  283466.00
#> 282  Int131           S6      Aged  292923.00
#> 283  Int126           S1     Young   17422.00
#> 284  Int127           S2     Young   14461.00
#> 285  Int128           S3     Young   19527.00
#> 286  Int129           S4      Aged   20570.00
#> 287  Int130           S5      Aged   18280.00
#> 288  Int131           S6      Aged   20299.00
#> 289  Int126           S1     Young  309173.00
#> 290  Int127           S2     Young  329409.00
#> 291  Int128           S3     Young  332731.00
#> 292  Int129           S4      Aged  350231.00
#> 293  Int130           S5      Aged  307258.00
#> 294  Int131           S6      Aged  305197.00
#> 295  Int126           S1     Young   12807.00
#> 296  Int127           S2     Young   12774.00
#> 297  Int128           S3     Young   14551.00
#> 298  Int129           S4      Aged   15281.00
#> 299  Int130           S5      Aged   12697.00
#> 300  Int131           S6      Aged   16294.00
#> 301  Int126           S1     Young   25715.00
#> 302  Int127           S2     Young   25052.00
#> 303  Int128           S3     Young   35943.00
#> 304  Int129           S4      Aged   24711.00
#> 305  Int130           S5      Aged   32446.00
#> 306  Int131           S6      Aged   31171.00
#> 307  Int126           S1     Young   35830.00
#> 308  Int127           S2     Young   34670.00
#> 309  Int128           S3     Young   49325.00
#> 310  Int129           S4      Aged   43464.00
#> 311  Int130           S5      Aged   45100.00
#> 312  Int131           S6      Aged   49575.00
#> 313  Int126           S1     Young   59681.00
#> 314  Int127           S2     Young   60937.00
#> 315  Int128           S3     Young   81080.00
#> 316  Int129           S4      Aged   53598.00
#> 317  Int130           S5      Aged   64320.00
#> 318  Int131           S6      Aged   68079.00
#> 319  Int126           S1     Young   10653.00
#> 320  Int127           S2     Young    8954.00
#> 321  Int128           S3     Young   14287.00
#> 322  Int129           S4      Aged   11624.00
#> 323  Int130           S5      Aged    7735.00
#> 324  Int131           S6      Aged    9432.00
#> 325  Int126           S1     Young  261339.00
#> 326  Int127           S2     Young  314666.00
#> 327  Int128           S3     Young  287928.00
#> 328  Int129           S4      Aged  344389.00
#> 329  Int130           S5      Aged  284725.00
#> 330  Int131           S6      Aged  341280.00
#> 331  Int126           S1     Young    6164.00
#> 332  Int127           S2     Young    6510.00
#> 333  Int128           S3     Young    9680.00
#> 334  Int129           S4      Aged    8892.00
#> 335  Int130           S5      Aged    8541.00
#> 336  Int131           S6      Aged    8108.00
#> 337  Int126           S1     Young   29667.00
#> 338  Int127           S2     Young   21042.00
#> 339  Int128           S3     Young   28738.00
#> 340  Int129           S4      Aged   25489.00
#> 341  Int130           S5      Aged   24756.00
#> 342  Int131           S6      Aged   20230.00
#> 343  Int126           S1     Young  405388.00
#> 344  Int127           S2     Young  341579.00
#> 345  Int128           S3     Young  467366.00
#> 346  Int129           S4      Aged  378380.00
#> 347  Int130           S5      Aged  380307.00
#> 348  Int131           S6      Aged  369580.00
#> 349  Int126           S1     Young   95483.00
#> 350  Int127           S2     Young   89353.00
#> 351  Int128           S3     Young  128521.00
#> 352  Int129           S4      Aged   98056.00
#> 353  Int130           S5      Aged   85049.00
#> 354  Int131           S6      Aged  104589.00
#> 355  Int126           S1     Young   36685.00
#> 356  Int127           S2     Young   28080.00
#> 357  Int128           S3     Young   41395.00
#> 358  Int129           S4      Aged   31342.00
#> 359  Int130           S5      Aged   25779.00
#> 360  Int131           S6      Aged   29508.00
#> 361  Int126           S1     Young  397149.00
#> 362  Int127           S2     Young  391438.00
#> 363  Int128           S3     Young  457870.00
#> 364  Int129           S4      Aged  394444.00
#> 365  Int130           S5      Aged  392321.00
#> 366  Int131           S6      Aged  391704.00
#> 367  Int126           S1     Young   18222.00
#> 368  Int127           S2     Young   19487.00
#> 369  Int128           S3     Young   28596.00
#> 370  Int129           S4      Aged   24249.00
#> 371  Int130           S5      Aged   25909.00
#> 372  Int131           S6      Aged   24806.00
#> 373  Int126           S1     Young   25394.00
#> 374  Int127           S2     Young   28637.00
#> 375  Int128           S3     Young   35828.00
#> 376  Int129           S4      Aged   35047.00
#> 377  Int130           S5      Aged   29376.00
#> 378  Int131           S6      Aged   35531.00
#> 379  Int126           S1     Young    9186.00
#> 380  Int127           S2     Young    7492.00
#> 381  Int128           S3     Young    9863.00
#> 382  Int129           S4      Aged    8548.00
#> 383  Int130           S5      Aged   10265.00
#> 384  Int131           S6      Aged    9995.00
#> 385  Int126           S1     Young   41637.00
#> 386  Int127           S2     Young   45788.00
#> 387  Int128           S3     Young   41690.00
#> 388  Int129           S4      Aged   52230.00
#> 389  Int130           S5      Aged   49071.00
#> 390  Int131           S6      Aged   55075.00
#> 391  Int126           S1     Young   16573.00
#> 392  Int127           S2     Young   12783.00
#> 393  Int128           S3     Young   21513.00
#> 394  Int129           S4      Aged   16301.00
#> 395  Int130           S5      Aged   19374.00
#> 396  Int131           S6      Aged   20353.00
#> 397  Int126           S1     Young  129168.00
#> 398  Int127           S2     Young  123658.00
#> 399  Int128           S3     Young  167076.00
#> 400  Int129           S4      Aged  128464.00
#> 401  Int130           S5      Aged  139097.00
#> 402  Int131           S6      Aged  129680.00
#> 403  Int126           S1     Young  890653.00
#> 404  Int127           S2     Young  776233.00
#> 405  Int128           S3     Young 1127000.00
#> 406  Int129           S4      Aged  935587.00
#> 407  Int130           S5      Aged  887078.00
#> 408  Int131           S6      Aged  922503.00
#> 409  Int126           S1     Young  154247.00
#> 410  Int127           S2     Young  191712.00
#> 411  Int128           S3     Young  285989.00
#> 412  Int129           S4      Aged  170749.00
#> 413  Int130           S5      Aged  226149.00
#> 414  Int131           S6      Aged  178835.00
#> 415  Int126           S1     Young   30556.00
#> 416  Int127           S2     Young   25329.00
#> 417  Int128           S3     Young   36435.00
#> 418  Int129           S4      Aged   25681.00
#> 419  Int130           S5      Aged   30169.00
#> 420  Int131           S6      Aged   32793.00
#> 421  Int126           S1     Young    6807.00
#> 422  Int127           S2     Young    6477.00
#> 423  Int128           S3     Young    6491.00
#> 424  Int129           S4      Aged   10069.00
#> 425  Int130           S5      Aged    6389.00
#> 426  Int131           S6      Aged    7822.00
#> 427  Int126           S1     Young  503037.00
#> 428  Int127           S2     Young  440529.00
#> 429  Int128           S3     Young  538371.00
#> 430  Int129           S4      Aged  605475.00
#> 431  Int130           S5      Aged  499790.00
#> 432  Int131           S6      Aged  563186.00
#> 433  Int126           S1     Young   12705.00
#> 434  Int127           S2     Young   10385.00
#> 435  Int128           S3     Young   16191.00
#> 436  Int129           S4      Aged   13560.00
#> 437  Int130           S5      Aged   11680.00
#> 438  Int131           S6      Aged   14529.00
#> 439  Int126           S1     Young   65328.00
#> 440  Int127           S2     Young   53024.00
#> 441  Int128           S3     Young   74512.00
#> 442  Int129           S4      Aged   59279.00
#> 443  Int130           S5      Aged   55524.00
#> 444  Int131           S6      Aged   66125.00
#> 445  Int126           S1     Young  110116.00
#> 446  Int127           S2     Young   61744.00
#> 447  Int128           S3     Young  103338.00
#> 448  Int129           S4      Aged   92655.00
#> 449  Int130           S5      Aged   84067.00
#> 450  Int131           S6      Aged   88576.00
#> 451  Int126           S1     Young   30588.00
#> 452  Int127           S2     Young   19488.00
#> 453  Int128           S3     Young   25335.00
#> 454  Int129           S4      Aged   21228.00
#> 455  Int130           S5      Aged   20312.00
#> 456  Int131           S6      Aged   21478.00
#> 457  Int126           S1     Young   27268.00
#> 458  Int127           S2     Young   16975.00
#> 459  Int128           S3     Young   26186.00
#> 460  Int129           S4      Aged   16114.00
#> 461  Int130           S5      Aged   14777.00
#> 462  Int131           S6      Aged   17144.00
#> 463  Int126           S1     Young   45615.00
#> 464  Int127           S2     Young   21317.00
#> 465  Int128           S3     Young   31804.00
#> 466  Int129           S4      Aged   26127.00
#> 467  Int130           S5      Aged   22500.00
#> 468  Int131           S6      Aged   24651.00
#> 469  Int126           S1     Young   21599.00
#> 470  Int127           S2     Young   20871.00
#> 471  Int128           S3     Young   29493.00
#> 472  Int129           S4      Aged   26153.00
#> 473  Int130           S5      Aged   21770.00
#> 474  Int131           S6      Aged   23449.00
#> 475  Int126           S1     Young   48096.00
#> 476  Int127           S2     Young   44829.00
#> 477  Int128           S3     Young   59058.00
#> 478  Int129           S4      Aged   51355.00
#> 479  Int130           S5      Aged   52614.00
#> 480  Int131           S6      Aged   55591.00
#> 481  Int126           S1     Young   16264.00
#> 482  Int127           S2     Young   14004.00
#> 483  Int128           S3     Young   19997.00
#> 484  Int129           S4      Aged   15074.00
#> 485  Int130           S5      Aged   15489.00
#> 486  Int131           S6      Aged   18055.00
#> 487  Int126           S1     Young    9194.00
#> 488  Int127           S2     Young    8008.00
#> 489  Int128           S3     Young   13329.00
#> 490  Int129           S4      Aged   11390.00
#> 491  Int130           S5      Aged   11518.00
#> 492  Int131           S6      Aged   12827.00
#> 493  Int126           S1     Young    7612.00
#> 494  Int127           S2     Young    4088.00
#> 495  Int128           S3     Young    6987.00
#> 496  Int129           S4      Aged    5719.00
#> 497  Int130           S5      Aged    5293.00
#> 498  Int131           S6      Aged    6796.00
#> 499  Int126           S1     Young    4256.00
#> 500  Int127           S2     Young    9113.00
#> 501  Int128           S3     Young    7752.00
#> 502  Int129           S4      Aged    7307.00
#> 503  Int130           S5      Aged    3149.00
#> 504  Int131           S6      Aged    5315.00
#> 505  Int126           S1     Young   15931.00
#> 506  Int127           S2     Young   18498.00
#> 507  Int128           S3     Young   20685.00
#> 508  Int129           S4      Aged   18930.00
#> 509  Int130           S5      Aged   12392.00
#> 510  Int131           S6      Aged   17782.00
#> 511  Int126           S1     Young  123151.00
#> 512  Int127           S2     Young   98105.00
#> 513  Int128           S3     Young  154558.00
#> 514  Int129           S4      Aged  114114.00
#> 515  Int130           S5      Aged  105281.00
#> 516  Int131           S6      Aged  137472.00
#> 517  Int126           S1     Young  201913.00
#> 518  Int127           S2     Young  199496.00
#> 519  Int128           S3     Young  259596.00
#> 520  Int129           S4      Aged  227527.00
#> 521  Int130           S5      Aged  227203.00
#> 522  Int131           S6      Aged  245297.00
#> 523  Int126           S1     Young    5972.00
#> 524  Int127           S2     Young    3731.00
#> 525  Int128           S3     Young    5337.00
#> 526  Int129           S4      Aged    4200.00
#> 527  Int130           S5      Aged    3611.00
#> 528  Int131           S6      Aged    5444.00
#>